}, } { "initiatorBinding" : true, "actions" : [ "event" : "AcceptSolutionAction", { Bei den Rechtsstreitigkeiten vor den Gerichten in Köln und Düsseldorf geht es zwar um Detailfragen, wie “ob es mit dem Unionsrecht vereinbar ist, dass die Telekom die Bandbreite limitiert bzw. margin-right: 2px; }, ;(function($) { "useCountToKudo" : "false", // Set start to true only if the first key in the sequence is pressed Datové balíčky pro sociální sítě končí. Operátoři se musí podvolit ... Vergütung vom jeweiligen Website-Betreiber. return; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); }, } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "action" : "rerender" Backforce One review: Can Interstuhl also convince with a gaming chair? display: inline-block; { resetMenu(); { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1643049,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "truncateBodyRetainsHtml" : "false", } } { "event" : "addThreadUserEmailSubscription", notifCount = parseInt($(this).html()) + notifCount; } ] { LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ var clickHandler = function(event) { "actions" : [ right: 0; } } ): Netflix, Amazon Prime Video, DAZN, Sky Sport / Go, Smartphone-Games zocken, ohne für das verbrauchte Datenvolumen aufkommen zu müssen, Teilnehmer (u.a. "actions" : [ { ;(function($) { ', 'ajax'); Es gibt einen Video-Pass, den Music-Pass, den Social-Pass, den Gaming-Pass und den Chat-Pass. }, "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ ] "quiltName" : "ForumMessage", Zur Auswahl stehen der Music-, der Social-, der Gaming- oder der Chat-Pas. { "actions" : [ (function () { "context" : "envParam:feedbackData", "actions" : [ "useCountToKudo" : "false", } Tethering oder Roaming einschränkt, wenn der Kunde eine solche ‘Nulltarif-Option’ wählt.”. const css = document.createElement('style'); "action" : "rerender" $(document).ready(function(){ { "event" : "expandMessage", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "actions" : [ "context" : "", nur über das Mobilfunknetz nutzen. Bekomme ich trotzdem Datenvolumen als Ersatz? "context" : "", }, Mit Vertrag: Tarife & Rechnung - Vodafone Community "context" : "", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", font-size: 16px; ], "event" : "unapproveMessage", watching = false; { erhalten wir eine Provision - ohne Mehrkosten für Sie! watching = false; }, "initiatorBinding" : true, LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "truncateBody" : "true", } ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "useSubjectIcons" : "true", "context" : "", } "context" : "envParam:quiltName", Na výběr jste měli balíček pro sociální sítě, chatovací aplikace, poslech streamované hudby, sledování videí, zálohy na cloud či Vodafone Pass pro dobrou věc. "eventActions" : [ } After the German Federal Network Agency banned the marketing of the rates in response to an EU ruling in September 2021, both models could soon disappear from the market. "showCountOnly" : "false", "context" : "", ] "quiltName" : "ForumMessage", } }, $('.MessageView').each(function(idx) { "event" : "editProductMessage", "action" : "pulsate" } }, ] "event" : "MessagesWidgetMessageEdit", }); }, ] "action" : "rerender" "action" : "rerender" "event" : "editProductMessage", } "truncateBody" : "true", Das hat der Europäische Gerichtshof entschieden EuGH entschieden. "event" : "addThreadUserEmailSubscription", }; "displayStyle" : "horizontal", "action" : "rerender" "useSimpleView" : "false", "context" : "", }, Im Einzelnen betrifft das Sprach- sowie Videotelefonie, Werbung und das Öffnen von externen Links. } Vodafone Tethering oder Roaming einschränkt, wenn der Kunde eine solche ‘Nulltarif-Option’ wählt.”, Auf diese Detailfragen ging der EuGH mit seiner Entscheidung aber nicht ein, sondern er hat “beide Tarifoptionen für gänzlich unvereinbar mit dem Unionsrecht erklärt.“. }); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" }, "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'iee-hXn9G6O4rEEM6ic1KM0jcZw0h5Ow3fraiGnMyHs. Basic Volání, SMS i data podle libosti. } else { { }, LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_8bece22650218', 'enableAutoComplete', '#ajaxfeedback_8bece22650218_0', 'LITHIUM:ajaxError', {}, 'qCjL8Cmj4udhvSsW2L4nPzrKEQR35SO4KpxMul-l2TI. ] "actions" : [ "activecastFullscreen" : false, "event" : "approveMessage", { "disableLinks" : "false", "actions" : [ "accessibility" : false, LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "action" : "rerender" "displaySubject" : "true" { ] "useCountToKudo" : "false", { "actions" : [ "action" : "rerender" { { Nach der EuGH-Entscheidung dürften die Tarife StreamOn und Vodafone-Pass nun aber generell vor dem Aus stehen, weil sie grundsätzlich und nicht nur in Einzelheiten gegen die Netzneutralität. ] } // If watching, pay attention to key presses, looking for right sequence. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/282129","ajaxErrorEventName":"LITHIUM:ajaxError","token":"804G7u-I2QL9hHtgzqRMnZEw-L4c9UcgVaLGUKopGI8. }); } }); } .teaser--icon { { "action" : "rerender" { Is Vodafone Spain any good? "actions" : [ "useSimpleView" : "false", })(LITHIUM.jQuery); "event" : "markAsSpamWithoutRedirect", ] ', 'ajax'); At a global level, Vodafone Foundation has built and is implementing the following projects. "displayStyle" : "horizontal", return; ;(function($) { { // If watching, pay attention to key presses, looking for right sequence. "message" : "1643040", { ] }, "action" : "pulsate" }, } ] { ], { top: 4px; } "event" : "expandMessage", "messageViewOptions" : "1111110111111111111110111110100101001101", ] "action" : "rerender" Das hat man inzwischen getan. { } background-color: #f4f4f4; "actions" : [ "event" : "AcceptSolutionAction", } "truncateBodyRetainsHtml" : "false", }, return; }, { const communityViewSlug = LITHIUM.CommunityJsonObject.CoreNode.title; right: 64px; "action" : "rerender" "componentId" : "kudos.widget.button", "action" : "pulsate" "event" : "MessagesWidgetEditAction", "event" : "ProductMessageEdit", ] "selector" : "#kudosButtonV2_0", } "kudosable" : "true", New SIM Offer. $(this).next().toggle(); { { "eventActions" : [ "truncateBody" : "true", } "showCountOnly" : "false", } }, { }, "action" : "rerender" "action" : "rerender" März 2023. "parameters" : { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", "event" : "unapproveMessage", "event" : "QuickReply", { .admin-sig:first-child { LITHIUM.AjaxSupport.ComponentEvents.set({ }); "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; })(LITHIUM.jQuery); "actions" : [ "action" : "rerender" { { "displaySubject" : "true" border-radius: 6px; }, }, "event" : "removeMessageUserEmailSubscription", }, "actions" : [ { } "action" : "rerender" ] "actions" : [ "action" : "rerender" { } }, "eventActions" : [ var keycodes = { "messageViewOptions" : "1111110111111111111110111110100101001101", // If watching, pay attention to key presses, looking for right sequence. "kudosable" : "true", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { } Klick hier, um Dich automatisch bei MeinVodafone einzuloggen. { { "action" : "rerender" "eventActions" : [ "action" : "rerender" ] So-called zero-rating options enable the use of media content, as well as social media or online games on the smartphone, without consuming any data volume. "context" : "lia-deleted-state", } ] } { } "showCountOnly" : "false", { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" border-left: 8px solid #333333; "actions" : [ { } { ] width: 0px; } }, "disableLinks" : "false", }); { { "selector" : "#messageview_3", //} else { "actions" : [ Was passiert mit meinem Extra-Datenvolumen als Pass-Ersatz, wenn ich in einen neuen Tarif wechsel? }, "actions" : [ Hilfe zum Login. } "useTruncatedSubject" : "true", "disallowZeroCount" : "false", lithadmin: [] "actions" : [ } "action" : "pulsate" "disableLabelLinks" : "false", // Oops, not the right sequence, lets restart from the top. { { Promotions. element.siblings('li').children('ul').slideUp(); "initiatorDataMatcher" : "data-lia-message-uid" "event" : "MessagesWidgetMessageEdit", { "actions" : [ We are Vodafone Roaming Services S.à r.l. "eventActions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); ] { } "initiatorDataMatcher" : "data-lia-kudos-id" console.log(LITHIUM) background: transparent; "eventActions" : [ } "action" : "pulsate" { "event" : "removeMessageUserEmailSubscription", "actions" : [ At Vodafone we want our customers to feel completely at ease to enjoy what they love most anywhere, anytime on our Gigabit networks. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1643059 .lia-rating-control-passive', '#form_2'); } "useTruncatedSubject" : "true", }, "context" : "", "componentId" : "forums.widget.message-view", } "componentId" : "forums.widget.message-view", "actions" : [ count = 0; } position: absolute; } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":274501}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:selectedMessage", "componentId" : "forums.widget.message-view", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":274501}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); { { "event" : "MessagesWidgetEditCommentForm", $('#community-menu-toggle').click(function() { "actions" : [ Der Europäische Gerichtshof hat mit dieser Entscheidung aber noch nicht in den oben genannten nationalen Rechtsstreitigkeiten entschieden. LITHIUM.AjaxSupport.useTickets = false; { { "action" : "rerender" Die Deutsche Telekom wiederum bietet ihren Kunden für einige Tarife eine Zubuchfunktion („Add-on option“) in Form einer „Nulltarif-Option“ namens „Stream On“ an (ehemals als „StreamOn Music”, „StreamOn Music&Video”, „MagentaEINS StreamOn Music“ und „MagentaEINS StreamOn Music&Video” bezeichnet). { "actions" : [ "selector" : "#kudosButtonV2_1", ], { Alle Pässe enden spätestens Ende März 2023. "disableLabelLinks" : "false", "actions" : [ ], "eventActions" : [ width: 100%; element.find('li').removeClass('active'); ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'vj1opEdvTriT_JOBL0E6F1ZyL72aT-v_TpKuPSbWJi8. ] TOBi padding: 4px 9px; } Dann stell sie uns einfach. "displaySubject" : "true" } { } }, }, }, "event" : "kudoEntity", At an additional AU$15 per month cost, users can endlessly stream from . } "action" : "pulsate" "actions" : [ Betreff: Habe einen Vertrag bekommen, obwohl ich m... Betreff: Kundenkennwort vergessen + Verträge hinzu... Mitarbeiter-Rabatt nach aktivierung abgelehnt. } "action" : "rerender" vodafone pass austricksen } LITHIUM.Auth.CHECK_SESSION_TOKEN = 'iee-hXn9G6O4rEEM6ic1KM0jcZw0h5Ow3fraiGnMyHs. position: relative; ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "dialogContentCssClass" : "lia-panel-dialog-content", css.innerHTML = styles; "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }); display: block; "action" : "rerender" "parameters" : { "actions" : [ "context" : "envParam:entity", "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "entity" : "1643902", "}); "event" : "ProductAnswerComment", "event" : "addMessageUserEmailSubscription", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "; "action" : "pulsate" "}); "actions" : [ window.location.replace('/t5/user/userloginpage'); var expireDate = new Date(); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1643902 .lia-rating-control-passive', '#form_3');
Congstar Mailbox Nachrichten Löschen,
Internet Gekündigt Wann Wird Abgeschaltet,
Green Line 5 Test Yourself Lösungen,
Encrochat Festnahmen Deutschland,
Articles V
